Pay in 4 interest-free payments of $38.50 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
the colored protein marker shows different mobilities and slightly different molecular weights
animal feed
Robust performance: Superior specificity
Figure B: Flow cytometry analysis of Human Lymphocyte Separation Medium
CASP3 rabbit polyclonal antibody Package Size:50 μl DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCSSpecification Full name CASP3 rabbit polyclonal antibody Alternative names 50 l 100 l Reactivity rabbit polyclonal Applications WB, IHC Host Rabbit Clone type rabbit polyclonal Target Background The protein encoded by this gene is a cysteine aspartic acid protease that plays a central role in the execution phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP ribose) polymerase while it cleaves and activates sterol regulatory
US$ 249.97
US$ 27.95
US$ 137.68
US$ 550.00
US$ 250.00
US$ 550.00